General Information

  • ID:  hor000199
  • Uniprot ID:  O76534
  • Protein name:  Probable molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Metapenaeus ensis (Greasyback shrimp) (Penaeus ensis)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Expressed in the postmolt, intermolt, and premolt stages of the shrimp eyestalks and the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Metapenaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYIENTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRDRCFNNEWFLVCLKAANRDDELDKFKVWISILNPGL
  • Length:  77
  • Propeptide:  MYRMPMRFWLTAVVMVVVGALLLDTASASYIENTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRDRCFNNEWFLVCLKAANRDDELDKFKVWISILNPGL
  • Signal peptide:  MYRMPMRFWLTAVVMVVVGALLLDTASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-O76534-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000199_AF2.pdbhor000199_ESM.pdb

Physical Information

Mass: 1034825 Formula: C394H622N112O113S8
Absent amino acids: HQ Common amino acids: DLNRCV
pI: 7.73 Basic residues: 12
Polar residues: 24 Hydrophobic residues: 26
Hydrophobicity: -24.29 Boman Index: -15861
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.97
Instability Index: 2059.48 Extinction Coefficient cystines: 14355
Absorbance 280nm: 188.88

Literature

  • PubMed ID:  9701616
  • Title:  Cloning of a cDNA Encoding a Putative Molt-Inhibiting Hormone From the Eyestalk of the Sand Shrimp Metapenaeus Ensis